Invitrogen™ Human FAM120B (aa 448-560) Control Fragment Recombinant Protein

Product Code. 30212360

Brand: Invitrogen™ RP94700

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57985 (PA5-57985. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transcription factor peroxisome proliferator-activated receptor -gamma (PPARg) plays essential roles in adipogenesis by regulating adipocyte-specific genes through association of various co-factors. One such co-factor, PGCC1 (also known as FAM120B), is widely expressed in adult tissues and throughout embryonic development. Overexpression of this protein in OP9 pre-adipocytes promoted their differentiation into adipocytes, and knockdown of PGCC1 expression through RNA interference blocked this process. PGCC1 is homologous to C9orf10 (also known as FAM120A) and has been mapped to chromosome Xp11.22. At least two isoforms of PGCC1 are known to exist.

Specifications

• Accession Number: Q96EK7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84498
• Name: Human FAM120B (aa 448-560) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932442K08Rik; AW049283; AW413338; CCPG; Constitutive coactivator of peroxisome proliferator-activated receptor gamma; constitutive coactivator of PPARG; constitutive coactivator of PPAR-gamma; dJ894D12.1; f120b; FAM120B; family with sequence similarity 120, member B; family with sequence similarity 120 B; KIAA1838; mKIAA1838; PGCC1; PPARG constitutive coactivator 1; PPARgamma constitutive coactivator 1; Protein FAM120B; RGD1310304
• Common Name: FAM120B
• Gene Symbol: FAM120B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVPMYTGSEPRQEVPMYTGPESRQEVPMYTGPESRQEVLIRTDPESRQEIMCTGHESKQEVPICTDPISKQEDSMCTHAEINQKLPVATDFEFKLEALMCTNPEIKQEDPTNV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining