Invitrogen™ Human FAM117B (aa 146-268) Control Fragment Recombinant Protein

Product Code. 30203038

Brand: Invitrogen™ RP102549

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55968 (PA5-55968. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM117B is encoded by ALS2CR13 which is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2).

Specifications

• Accession Number: Q6P1L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 150864
• Name: Human FAM117B (aa 146-268) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810425F24Rik; 6330416D14Rik; Als2cr13; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 13; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 13 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 13 protein homolog; FAM117B; family with sequence similarity 117 member B; family with sequence similarity 117, member B; protein FAM117B
• Common Name: FAM117B
• Gene Symbol: FAM117B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRSPEQSRSSPEKRSPSAPVCKAGDKTRQPSSSPSSIIRRTSSLDTLAAPYLAGHWPRDSHGQAAPCMRDKATQTESAWAEEYSEKKKGSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining