Invitrogen™ Human FAM116A (aa 553-603) Control Fragment Recombinant Protein

Product Code. 30194464

Brand: Invitrogen™ RP103775

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66508 (PA5-66508, PA5-64469 (PA5-64469. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanine nucleotide exchange factor (GEF) for RAB14. Component of an endocytic recycling pathway that is required for the control of ADAM10 transport, shedding of N-cadherin/CDH2 by ADAM9 or ADAM10 and regulation of cell-cell junctions. Required for RAB14 recruitment to recycling endosomes.

Specifications

• Accession Number: Q8IWF6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 201627
• Name: Human FAM116A (aa 553-603) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AFI1A; DENN domain containing 6 A; DENN domain-containing protein 6 A; DENN/MADD domain containing 6 A; DENND6A; FAM116A; family with sequence similarity 116, member A; protein DENND6A; protein FAM116A
• Common Name: FAM116A
• Gene Symbol: DENND6A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining