Invitrogen™ Human FAM111B (aa 3-89) Control Fragment Recombinant Protein

Product Code. 30195983

Brand: Invitrogen™ RP97540

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58474 (PA5-58474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM111B is a 734 amino acid protein that is encoded by a gene that maps to human chromosome 11, which makes up around 4% of human genomic DNA and isconsidered a gene and disease association dense chromosome.The chromosome 11 encoded Atmgene isimportant for regulation ofcellcycle arrest and apoptosisfollowing double strand DNA breaks. Atmmutation leads to the disorderknown as ataxia-telangiectasia. The blood disorders Sickle cell anemia and beta thalassemia are caused by HBB genemutations. Wilms' tumors, WAGR syndrome and Denys-Drash syndrome are associatedwithmutations of the WT1 gene. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are also associatedwith defectsin chromosome 11.

Specifications

• Accession Number: Q6SJ93
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 374393
• Name: Human FAM111B (aa 3-89) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cancer-associated nucleoprotein; CANP; FAM111B; family with sequence similarity 111 member B; family with sequence similarity 111, member B; POIKTMP; Protein FAM111B
• Common Name: FAM111B
• Gene Symbol: FAM111B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SMKTEENKSFSAMEDDQRTRPEVSKDTVMKQTHADTPVDHCLSGIRKCSSTFKLKSEVNKHETALEMQNPNLNNKECCFTFTLNGNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining