missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAM111A (aa 7-94) Control Fragment Recombinant Protein

Product Code. 30212684
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212684

Brand: Invitrogen™ RP97448

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58827 (PA5-58827. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

With approximately 135 million base pairs and 1,400 genes, chromosome 11 makes up around 4% of human genomic DNA and isconsidered a gene and disease association dense chromosome. The chromosome 11 encoded Atm gene isimportant for regulation ofcellcycle arrest and apoptosisfollowing double strand DNA breaks. Atmmutation leadsto the disorderknown as ataxia telangiectasia. The blood disorders Sickle cell anemia and β thalassemia are caused by HBB gene mutations. Wilms' tumors, WAGR syndrome and Denys-Drash syndrome are associated with mutations of the WT1 gene. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitzsyndrome are also associatedwith defectsin chromosome 11. The FAM111A gene product has been provisionally designated FAM111A pending furthercharacterization.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96PZ2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 63901
Name Human FAM111A (aa 7-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4632417K18Rik; AW413625; Fam111a; family with sequence similarity 111 member A; family with sequence similarity 111, member A; GCLEB; KCS2; Kiaa1895; Protein FAM111A; RGD1560913
Common Name FAM111A
Gene Symbol FAM111A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQTMPQNRTIYVTLKVNHRRNQDMKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.