Invitrogen™ Human FAM111A (aa 252-356) Control Fragment Recombinant Protein

Product Code. 30200808

Brand: Invitrogen™ RP97447

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59091 (PA5-59091. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

With approximately 135 million base pairs and 1,400 genes, chromosome 11 makes up around 4% of human genomic DNA and isconsidered a gene and disease association dense chromosome. The chromosome 11 encoded Atm gene isimportant for regulation ofcellcycle arrest and apoptosisfollowing double strand DNA breaks. Atmmutation leadsto the disorderknown as ataxia telangiectasia. The blood disorders Sickle cell anemia and β thalassemia are caused by HBB gene mutations. Wilms' tumors, WAGR syndrome and Denys-Drash syndrome are associated with mutations of the WT1 gene. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitzsyndrome are also associatedwith defectsin chromosome 11. The FAM111A gene product has been provisionally designated FAM111A pending furthercharacterization.

Specifications

• Accession Number: Q96PZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63901
• Name: Human FAM111A (aa 252-356) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4632417K18Rik; AW413625; Fam111a; family with sequence similarity 111 member A; family with sequence similarity 111, member A; GCLEB; KCS2; Kiaa1895; Protein FAM111A; RGD1560913
• Common Name: FAM111A
• Gene Symbol: FAM111A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STQPVDELEGRYFQVEVEKRMVPSAAASQNPESEKRNTCVLREQIVAQYPSLKRESEKIIENFKKKMKVKNGETLFELHRTTFGKVTKNSSSIKVVKLLVRLSDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining