missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FALZ (aa 785-913) Control Fragment Recombinant Protein

Product Code. 30198116
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30198116

missing translation for 'mfr': Invitrogen™ RP91662

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83057 (PA5-83057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BPTF (bromodomain and PHD domain transcription factor) is the largest subunit of the ATP-dependent chromatin-remodelling complex, NURF (nucleosome remodelling factor). NURF catalyses ATP-dependent nucleosome sliding and facilitates transcription. BPTF recognises histone H3 tails that are tri-methylated at K4, which marks the transcriptional start site of the vast majority of transcriptionally active genes. BPTF also exhibits some binding to H3 di-methylated at K4. BPTF plays a key role in the development of early mouse embryos, possibly through regulation of the Smad pathway of transcription factors. While BPTF is expressed in low levels in the adult brain and spinal cord, it is expressed in higher levels in the brain in neurodegenerative diseases. It is present in a subset of amyloid-containing plaques in the brains of patients suffering from Alzheimer's disease. Abundantly expressed in the fetal brain. Present throughout the gray and white matter of the developing spinal cord at 18-22 gestational weeks. Expressed at low levels in adult brain and spinal cord and reexpressed in neurodegenerative diseases (at protein level).Tissue specificity: Ubiquitously expressed, with highest levels in testis. Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex (at protein level).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12830
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2186
Name Human FALZ (aa 785-913) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430093H17Rik; BPTF; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; bromodomain PHD finger transcription factor; FAC1; FALZ; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; fetal Alzheimer antigen; nucleosome remodeling factor, large subunit; nucleosome-remodeling factor subunit BPTF; NURF301
Common Name FALZ
Gene Symbol BPTF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.