missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200474

Invitrogen™ Human FADS1 (aa 55-129) Control Fragment Recombinant Protein

Product Code. 30200474
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200474

Brand: Invitrogen™ RP100163

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the fatty acid desaturase gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13. 1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60427
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3992
Name Human FADS1 (aa 55-129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710001O03Rik; A930006B21Rik; Acyl-CoA (8-3)-desaturase; AI317215; BC269730_2; D5D; delta(5) desaturase; delta(5) fatty acid desaturase; delta-5 desaturase; delta-5 fatty acid desaturase; DSD; FADS1; FADS6; FADSD5; Fatty acid desaturase 1; FLJ38956; FLJ90273; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1; LLCDL1; TU12
Common Name FADS1
Gene Symbol FADS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.