Invitrogen™ Human Factor XIII A (aa 46-181) Control Fragment Recombinant Protein

Product Code. 30203286

Brand: Invitrogen™ RP100517

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110642 (PA5-110642. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the coagulation factor XIII A subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.

Specifications

• Accession Number: P00488
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2162
• Name: Human Factor XIII A (aa 46-181) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200014I03Rik; AI462306; bA525O21.1 (coagulation factor XIII, A1 polypeptide); coagulation factor XIII A chain; coagulation factor XIII, A polypeptide; coagulation factor XIII, A1 polypeptide; coagulation factor XIII, A1 subunit; coagulation factor XIII, alpha subunit; coagulation factor XIIIa; F13A; F13a1; factor viiia; Factor XIIIA; fibrin stabilizing factor, A subunit; fibrinoligase; FSF, A subunit; protein-glutamine gamma-glutamyltransferase A chain; RP11-232H4.1; TGase; transglutaminase A chain; transglutaminase. plasma
• Common Name: Factor XIII A
• Gene Symbol: F13A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining