Invitrogen™ Human FABP2 (aa 65-125) Control Fragment Recombinant Protein

Artikelnummer. 30208766

missing translation for 'mfr': Invitrogen™ RP95127

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83237 (PA5-83237. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play roles in fatty acid transport and compartmentalization.

Spezifikation

• Accession Number: P12104
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2169
• Name: Human FABP2 (aa 65-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FABP; Fabp2; Fabpi; fatty acid binding protein 1; fatty acid binding protein 2; fatty acid binding protein 2, intestinal; fatty acid-binding protein 2; Fatty acid-binding protein, intestinal; I-FABP; intestinal fatty acid binding protein; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein; MGC133132
• Common Name: FABP2
• Gene Symbol: FABP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining