Invitrogen™ Human FAAP24 (aa 109-206) Control Fragment Recombinant Protein

Product Code. 30181072

Brand: Invitrogen™ RP99091

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59464 (PA5-59464. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).

Specifications

• Accession Number: Q9BTP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91442
• Name: Human FAAP24 (aa 109-206) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C19orf40; FAAP24; Fanconi anemia core complex associated protein 24; Fanconi anemia core complex-associated protein 24; Fanconi anemia-associated protein of 24 kDa
• Common Name: FAAP24
• Gene Symbol: FAAP24
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining