Invitrogen™ Human FAAH (aa 319-409) Control Fragment Recombinant Protein

Product Code. 30193901

Brand: Invitrogen™ RP88602

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Degrades bioactive fatty acid amides like oleamide, the endogenous levels of cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.

Specifications

• Accession Number: O00519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2166
• Name: Human FAAH (aa 319-409) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: amide hydrolase; anandamide amidohydrolase 1; AW412498; FA2H; Faah; FAAH1; FAAH-1; fatty acid amide hydrolase; fatty acid amide hydrolase protein; fatty-acid amide hydrolase 1; fatty-acid amide hydrolase 1-like; LOC100911581; MGC102823; MGC138146; Oleamide hydrolase; Oleamide hydrolase 1; PSAB
• Common Name: FAAH
• Gene Symbol: FAAH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining