Invitrogen™ Human F1142 (aa 308-397) Control Fragment Recombinant Protein

Product Code. 30200187

Brand: Invitrogen™ RP96805

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57440 (PA5-57440. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM114A2 (Family With Sequence Similarity 114 Member A2) is a Protein Coding gene. Diseases associated with FAM114A2 include Postural Orthostatic Tachycardia Syndrome and Phencyclidine Abuse. Among its related pathways are Oncogenic MAPK signaling and HIV Life Cycle. Gene Ontology (GO) annotations related to this gene include purine nucleotide binding. An important paralog of this gene is FAM114A1. [GeneCards]

Specifications

• Accession Number: Q9NRY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10827
• Name: Human F1142 (aa 308-397) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 133K02; 1810073G14Rik; 9030624B09Rik; C5orf3; Fam114a2; family with sequence similarity 114 member A2; family with sequence similarity 114, member A2; protein FAM114A2; testis tissue sperm-binding protein Li 81 P
• Common Name: F1142
• Gene Symbol: FAM114A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFTKDITELFSQLHVSSKPEKLARARNTAHEWIRKSLTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining