Invitrogen™ Human EYS (aa 795-861) Control Fragment Recombinant Protein

Product Code. 30206820

Brand: Invitrogen™ RP94712

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55507 (PA5-55507. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q5T1H1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 346007
• Name: Human EYS (aa 795-861) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bA166P24.2; bA307F22.3; bA74E24.1; C6orf178; C6orf179; C6orf180; dJ1018A4.2; dJ22I17.2; dJ303F19.1; EGFL10; EGFL11; EGF-like protein 10; EGF-like protein 11; EGF-like-domain, multiple 10; EGF-like-domain, multiple 11; Epidermal growth factor-like protein 10; epidermal growth factor-like protein 11; eyes shut homolog (Drosophila); EYS; Protein eyes shut homolog; protein spacemaker homolog; RP25; SPAM; UNQ9424/PRO34591
• Common Name: EYS
• Gene Symbol: EYS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining