Invitrogen™ Human EXOSC3 (aa 99-173) Control Fragment Recombinant Protein

Product Code. 30209520

Brand: Invitrogen™ RP92912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82727 (PA5-82727. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EXOSC3 is component of the exosome 3'-5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5. 8S rRNA.

Specifications

• Accession Number: Q9NQT5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51010
• Name: Human EXOSC3 (aa 99-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310005D06Rik; AI593501; bA3J10.7; CGI-102; Exosc3; Exosome complex component RRP40; exosome complex exonuclease RRP40; exosome complex exonuclease RRP40; exosome complex component RRP40; exosome component 3; hRrp-40; hRrp40p; hypothetical protein LOC533245; LOW QUALITY PROTEIN: exosome complex component RRP40; p10; PCH1B; Ribosomal RNA-processing protein 40; RP11-3J10.8; RRP40; Rrp40p
• Common Name: EXOSC3
• Gene Symbol: Exosc3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining