missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196821

Invitrogen™ Human EXOSC10 (aa 102-177) Control Fragment Recombinant Protein

Product Code. 30196821
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196821

Brand: Invitrogen™ RP94454

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55869 (PA5-55869. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a nuclear/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl-2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl patients. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component ofthe RNA exosome complex which has 3'-5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q01780
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5394
Name Human EXOSC10 (aa 102-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Autoantigen PM/Scl 2; Autoantigen PM/Scl 2 homolog; autoantigen PM-SCL; Exosc10; Exosome component 10; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; p2; p3; p4; PM/Scl-100; PMSCL; PM-Scl; PMSCL2; Polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2; Polymyositis/scleroderma autoantigen 2 homolog; RRP6; Rrp6p
Common Name EXOSC10
Gene Symbol EXOSC10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.