missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206576

Invitrogen™ Human EXOC6 (aa 227-267) Control Fragment Recombinant Protein

Product Code. 30206576
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206576

Brand: Invitrogen™ RP97094

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57595 (PA5-57595. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TAG9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54536
Name Human EXOC6 (aa 227-267) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833405E05Rik; AW413330; C430002C19; DKFZp761I2124; Exoc6; EXOC6A; Exocyst complex component 6; exocyst complex component Sec15A; FLJ1125; FLJ11251; hbd; MGC33397; msec15; rSec15; rsec15-like protein; Sec15; SEC15 homolog; SEC15A; SEC15L; SEC15L1; SEC15L3; SEC15-like 1; SEC15-like protein 1; SEC15-like protein 3; Sec15p; zgc:77548
Common Name EXOC6
Gene Symbol Exoc6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.