Invitrogen™ Human EVC (aa 882-987) Control Fragment Recombinant Protein

Product Code. 30203428

Brand: Invitrogen™ RP89974

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52591 (PA5-52591. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing a leucine zipper and a transmembrane domain. This gene has been implicated in both Ellis-van Creveld syndrome (EvC) and Weyers acrodental dysostosis.

Specifications

• Accession Number: P57679
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2121
• Name: Human EVC (aa 882-987) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DWF-1; Ellis van Creveld gene homolog; Ellis van Creveld gene syndrome; Ellis van Creveld protein; Ellis van Creveld syndrome; ellis-van Creveld syndrome protein; Ellis-van Creveld syndrome protein homolog; EVC; EvC ciliary complex subunit 1; EvC protein (Ellis-van Creveld syndrome); EVC1; EVCL
• Common Name: EVC
• Gene Symbol: Evc
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining