Invitrogen™ Human ETV5 (aa 165-221) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30201077	100 μL	100µL

Product Code. 30201077 Supplier Invitrogen™ Supplier No. RP105253

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66555 (PA5-66555. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ETS variant 5, transcription factor of the ETS family, divergent member of the winged helix-turn-helix superfamily, expressed in brain, placenta and other tissues involved in development. Tissue specificity: Ubiquitous. ERM is expressed in Sertoli cells and spermatogonial stem cells (SSCs). Studies on knockout mice have shown that it is required for SSC self-renewal but not differentiation, thus affected mice exhibit progressive germ cell depletion.

Specifications

• Accession Number: P41161
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2119
• Name: Human ETV5 (aa 165-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110005E01Rik; 8430401F14Rik; ERM; ETS translocation variant 5; ets variant 5; ets variant gene 5; ets variant gene 5 (ets-related molecule); ets-related molecule; ets-related protein ERM; ETV5
• Common Name: ETV5
• Gene Symbol: ETV5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining