Invitrogen™ Human ETV3 (aa 147-225) Control Fragment Recombinant Protein

Product Code. 30204498

Brand: Invitrogen™ RP109328

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140147 (PA5-140147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity.

Specifications

• Accession Number: P41162
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2117
• Name: Human ETV3 (aa 147-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI414410; bA110J1.4; ETS domain transcriptional repressor PE1; ETS translocation variant 3; ETS variant 3; ets variant gene 3; ets variant gene 3, ETS family transcriptional repressor; ETS-domain protein; ETS-domain transcriptional repressor; Etv3; Mets; Mitogenic Ets transcriptional suppressor; mitogenic Ets transcriptional suppressor METS; Pe1; PE-1; SH2 domain containing phosphatase anchor protein 1; Spap1
• Common Name: ETV3
• Gene Symbol: ETV3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining