Invitrogen™ Human ETAA1 (aa 668-764) Control Fragment Recombinant Protein

Product Code. 30212448

Brand: Invitrogen™ RP102644

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57129 (PA5-57129. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ETAA1 (Ewing's tumor-associated antigen 1), also known as ETAA16, is a 926 amino acid cytoplasmic protein that is highly expressed in kidney, brain, liver and Ewing tumor cell lines. ETAA1 undergoes post-translational phosphorylation following DNA damage, most likely by either ATM or ATR, and is suggested to function as a tumour-specific cell surface antigen in Ewing's family of tumour cell lines. The gene encoding ETAA1 maps to human chromosome 2, which consists of 237 million bases, encodes over 1,400 genes and makes up approximately 8% of the human genome. A number of genetic diseases are linked to genes on chromosome 2 including Harlequin icthyosis, sitosterolemia and Alstrom syndrome.

Specifications

• Accession Number: Q9NY74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54465
• Name: Human ETAA1 (aa 668-764) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730466H23Rik; AA672646; Etaa1; ETAA16; Ewing tumor associated antigen 1; Ewing tumor-associated antigen 1; ewing's tumor-associated antigen 1; Ewing's tumor-associated antigen 1 homolog; ewing's tumor-associated antigen 16; RGD1560957
• Common Name: ETAA1
• Gene Symbol: ETAA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INNNSEHGAKNMFAISKQGSNLVQSKHLNPGSISVQTSLTNSSQIDKPMKMEKGEMYGNSPRFLGATNLTMYSKISNCQINNLHVSYTNTDVPIQVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining