missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Estrogen Receptor alpha (aa 89-230) Control Fragment Recombinant Protein

Product Code. 30195926
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195926

Brand: Invitrogen™ RP96614

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Estrogen Receptors (ER) are members of the steroid/thyroid hormone receptor superfamily of nuclear receptors. The estrogen receptor is a ligand-activated transcription factor, that when bound to estrogen hormone, induces a conformational change that allows dimerization and binding to estrogen response elements (ERE) in DNA. When bound to EREs, ER can positively or negatively regulate gene transcription through the recruitment of coactivator or corepressor proteins. There are two different forms of the estrogen receptor, alpha and beta, encoded by separate genes (ESR1 and ESR2, respectively). Due to alternative RNA splicing, at least 4 estrogen receptor-alpha isoforms are known to exist (Isoform 1 (66 kDa), Isoform 2 (53 kDa), Isoform 3 (47 kDa), Isoform 4 (35 kDa)). Estrogen receptors are widely expressed in different tissue types and are essential for sexual development and reproductive function. They also play a role in other tissues such as bone. Estrogen receptors are involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P03372
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2099
Name Human Estrogen Receptor alpha (aa 89-230) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DKFZp686N23123; ER; Er alpha; ER36; ERa; ERalpha; ER-alpha; ERalpha protein; ESR; esr 1; Esr1; esr-1; ESRA; Estr; Estra; Estradiol receptor; estrogen nuclear receptor alpha; Estrogen receptor; estrogen receptor 1; estrogen receptor 1 (alpha); estrogen receptor alpha; estrogen receptor alpha c-terminus splice variant 1-2; estrogen receptor alpha E1-E2-1-2; estrogen receptor alpha E1-N2-E2-1-2; estrogen receptor alpha splice variant, CTERP-1; estrogen receptor alpha splice variant, ERalphaDup5; estrogen receptor alpha splice variant, ERalphai45a; estrogen receptor alpha splice variant, ERalphai45bL; estrogen receptor alpha splice variant, ERalphai45bS; estrogen receptor alpha splice variant, ERalphai45c; estrogen receptor alpha splice variant, ERalphai56; estrogen receptor alpha splice variant, ERalphai67; estrogen receptor alpha variant delta 4; estrogen receptor protein; estrogen receptor, alpha; ESTRR; hER-alpha36; I79_001166; Nr3a1; nuclear receptor; nuclear receptor subfamily 3 group A member 1; RNESTROR; RP1-130E4.1; unnamed protein product
Common Name Estrogen Receptor alpha
Gene Symbol ESR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.