missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ESRP2 (aa 649-727) Control Fragment Recombinant Protein

Product Code. 30202087
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202087

Brand: Invitrogen™ RP104859

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83919 (PA5-83919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM35A, also known as ESRP2, is a mRNA splicing factor that with its related protein RBM35A (ESRP1) are coordinators of an epithelial cell-type-specific splicing program. Both RBM35B and RBM35A are involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs, suggesting that these proteins are global regulators of an epithelial regulatory network. Loss of this global ESRP-regulated epithelial splicing program induces the phenotypic changes in cell morphology that are observed during the epithelial-mesenchymal transition.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H6T0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80004
Name Human ESRP2 (aa 649-727) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530027K23Rik; Epithelial splicing regulatory protein 2; ESRP2; PP7059; RBM35B; RGD1310855; RNA binding motif protein 35 A; RNA binding motif protein 35 B; RNA-binding motif protein 35 B; RNA-binding protein 35 B
Common Name ESRP2
Gene Symbol ESRP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.