Invitrogen™ Human ESCO1 (aa 477-586) Control Fragment Recombinant Protein

Product Code. 30181366

Brand: Invitrogen™ RP98281

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60000 (PA5-60000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EFO1 (Establishment factor-like protein 1), also known as ESCO1 (establishment of cohesion 1 homolog1) or ESO1, is a member of the acetyltransferase family (GCN5 subfamily). It is a ubiquitously expressed nuclear protein that plays an important role in sister chromatid cohesion. At its C-terminus, EFO1 contains an H2C2 zinc finger motif and an acetyltransferase domain that exhibits acetyltransferase activity in vivo. Its N-terminus, containing two domains that are similar o alpha- and beta-type linker histone proteins, is essential for EFO1 association with chromosomes. EFO1 is responsible for coupling cohesion and DNA replication processes thereby ensuring proper pairing of sister chromatids. EFO1 is phosphorylated during mitosis and this may act to regulate EFO1 activity. Due to alternative splicing events, three EFO1 isoforms exist.

Specifications

• Accession Number: Q5FWF5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114799
• Name: Human ESCO1 (aa 477-586) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930014I12Rik; CTF; CTF7 homolog 1; ECO1; ECO1 homolog 1; EFO1; EFO1p; ESCO1; ESO1; ESO1 homolog 1; establishment factor-like protein 1; Establishment of cohesion 1 homolog 1; establishment of cohesion 1 homolog 1 (S. cerevisiae); establishment of sister chromatid cohesion N-acetyltransferase 1; establisment of cohesion 1 homolog 1; hEFO1; Kiaa1911; N-acetyltransferase ESCO1; N-acetyltransferase ESCO1 variant 2
• Common Name: ESCO1
• Gene Symbol: ESCO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERAPENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKIDTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining