Invitrogen™ Human ERVMER34-1 (aa 302-442) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30204406	100 μL	100µL

Product Code. 30204406 Supplier Invitrogen™ Supplier No. RP90380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52836 (PA5-52836. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9H9K5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100288413
• Name: Human ERVMER34-1 (aa 302-442) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Endogenous retroviral envelope protein HEMO; Endogenous retroviral envelope protein HEMO, 48 kDa form; Endogenous retroviral envelope protein HEMO, secreted form; endogenous retrovirus group MER34 member 1; endogenous retrovirus group MER34 member 1 Env polyprotein; endogenous retrovirus group MER34, member 1; ERVMER34-1; HEMO; HERV-MER_4q12 provirus ancestral Env polyprotein; Human endogenous MER34 (medium-reiteration-frequency-family-34) open reading frame; Human endogenous MER34 ORF; LP9056; LP9056 protein
• Common Name: ERVMER34-1
• Gene Symbol: ERVMER34-1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining