Invitrogen™ Human ERP29 (aa 38-111) Control Fragment Recombinant Protein

Product Code. 30180487

Brand: Invitrogen™ RP97662

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum. The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: P30040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10961
• Name: Human ERP29 (aa 38-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200015M03Rik; 2810446M09Rik; AW209030; C12orf8; endoplasmic reticulum lumenal protein ERp28; endoplasmic reticulum protein 29; endoplasmic reticulum protein ERp29; endoplasmic reticulum resident protein 28; Endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 31; endoplasmic retuclum protein 29; epididymis secretory protein Li 107; Erp28; ERp29; Erp31; HEL-S-107; PDIA9; PDI-DB; protein disulfide isomerase family A, member 9
• Common Name: ERP29
• Gene Symbol: Erp29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining