missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195146

Invitrogen™ Human ERLIN2 (aa 190-337) Control Fragment Recombinant Protein

Product Code. 30195146
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195146

Brand: Invitrogen™ RP95924

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51669 (PA5-51669. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERLIN2, also named as C8orf2 and SPFH2, is a component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1, 4, 5-trisphosphate receptors (IP3Rs) such as ITPR1. It promotes sterol-accelerated ERAD of HMGCR probably implicating an AMFR/gp78-containing ubiquitin ligase complex. ERLIN2 is involved in regulation of cellular cholesterol homeostasis by regulation the SREBP signaling pathway. The MW of ERLIN1/ERLIN2 complex is about 70 kDa.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94905
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11160
Name Human ERLIN2 (aa 190-337) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC036333; C87251; C8orf2; EMBL:AAI68668.1, ECO:0000312; EMBL:AAI68668.1}; endoplasmic reticulum lipid raft-associated protein 2; endoplasmic reticulum lipid raft-associated protein 2 {ECO:0000250; ER lipid raft associated 2; Erlin2; erlin-2; erlin-2 {ECO:0000250; erlin2 {ECO:0000312; HGNC:1356; MGC87072; NET32; RGD:1309010}; RGD1309010; SPFH domain family, member 2; SPFH domain-containing protein 2; SPFH domain-containing protein 2 {ECO:0000250; Spfh2; SPG18; stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2; stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 {ECO:0000250; UniProtKB:Q8BFZ9, ECO:0000312; UniProtKB:Q8BFZ9}; UNQ2441; UNQ2441/PRO5003/PRO9924
Common Name ERLIN2
Gene Symbol ERLIN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.