Invitrogen™ Human ERI1 (aa 83-141) Control Fragment Recombinant Protein

Product Code. 30204700

Brand: Invitrogen™ RP103246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63244 (PA5-63244. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.

Specifications

• Accession Number: Q8IV48
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90459
• Name: Human ERI1 (aa 83-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3' exoribonuclease; 3' exoribonuclease; 3110010F15Rik; 3'-5' exonuclease ERI1; 3'-5' exoribonuclease 1; 3'EXO; 3'HEXO; enhanced RNAi protein 1; enhanced RNAi three prime mRNA exonuclease homolog 1; ERI1; eri-1; Eri-1 homolog; exoribonuclease 1; HEXO; histone mRNA 3' end-specific exonuclease; histone mRNA 3'-end-specific exoribonuclease; Histone mRNA 3'-exonuclease 1; protei; protein 3'hExo; RGD1308378; The x 1; three prime histone mRNA exonuclease 1; three prime mRNA exonuclease 1
• Common Name: ERI1
• Gene Symbol: ERI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining