Invitrogen™ Human eRF1 (aa 343-431) Control Fragment Recombinant Protein

Product Code. 30212561

Brand: Invitrogen™ RP102771

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57982 (PA5-57982. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors.

Specifications

• Accession Number: P62495
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2107
• Name: Human eRF1 (aa 343-431) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI463371; D5S1995; D6Ertd109e; ERF; ERF1; ETF1; Eukaryotic peptide chain release factor subunit 1; eukaryotic release factor 1; eukaryotic translation termination factor 1; polypeptide chain release factor 1; protein Cl1; RF1; sup45 (yeast omnipotent suppressor 45) homolog-like 1; SUP45L1; TB3-1
• Common Name: eRF1
• Gene Symbol: ETF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining