Invitrogen™ Human ErbB4 (aa 995-1097) Control Fragment Recombinant Protein

Product Code. 30209996

Brand: Invitrogen™ RP88798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82452 (PA5-82452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oncogene ERBB4 (HER4) is a member of the type I receptor protein tyrosine subfamily that includes EGFR, ERBB2, and ERBB3. ERBB4 binds and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. ErbB 4 is activated by neuregulins and NTAK (neural and thymus derived activator for ErbB kinases). ErbB 4 is a receptor for heregulin and is capable of mediating HGL-stimulated tyrosine phosphorylation of itself. Like other protein kinases, ErbB 4 mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. ErbB 4 is most predominantly expressed in several breast carcinoma cell lines, and in normal skeletal muscle, heart, pituitary, brain, and cerebellum. Breast tumor cell lines T47-D, MDA-MB-453, BT-474 and H3396 are found to have the highest levels of mRNA, and intermediate levels are seen in MCF-7, MDAMB-330 and MDA-MB-361. Expression of ErbB 4 is low or absent in some breast tumor cell lines such as MDA-MB-231, MDA-MB-157, MDA-MB-468, and SKBR-3. ErbB 4 levels have been found to be elevated in certain human tumor cell lines suggesting that it may play a role in some malignancies.

Specifications

• Accession Number: Q15303
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2066
• Name: Human ErbB4 (aa 995-1097) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4 ICD; ALS19; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; avian erythroblastosis oncogene B 4; c-erbB-4; erb-b2 receptor tyrosine kinase 4; Erbb4; ERBB4 intracellular domain; ERBB4 transcript variant I12DEL; ERBB4 transcript variant I20DEL; Her4; human epidermal growth factor receptor 4; Mer4; OTTHUMP00000209432; p180erbB4; proto-oncogene-like protein c-ErbB-4; receptor tyrosine kinase; receptor tyrosine-protein kinase erbB-4; s80HER4; Tyro-2; Tyrosine kinase-type cell surface receptor HER4; v-erb-a erythroblastic leukemia viral oncogene homolog 4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v-erb-b2 avian erythroblastic leukemia viral oncogene 4; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
• Common Name: ErbB4
• Gene Symbol: ERBB4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining