Invitrogen™ Human ErbB3 (aa 1022-1116) Control Fragment Recombinant Protein

Product Code. 30211257

Brand: Invitrogen™ RP100533

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ErbB3 (c-erbB-3/HER-3) is a member of the type I family of growth factor receptors and binds to ligands in the heregulin family. ErbB3 is over-expressed in a variety of tumors in the prostate, bladder, breast, stomach, pancreas, and colon. Heregulin and EGF stimulate tyrosine phosphorylation of c-erbB-3 to different extents. The ErbB3 gene is located on the long arm of human chromosome 12 (12q13) and is transcribed into a 6. 2kb mRNA which is translated into a 160/180 kDa glycoprotein. The ErbB3 gene encodes a transmembrane receptor tyrosine kinase due to alternative splicing and forms heterodimers with other EGF receptor family members that have kinase activity. Heterodimerization leads to the activation of pathways that lead to cell proliferation or differentiation. Alternate transcriptional splice variants encoding different isoforms of ErbB3 have been characterized. One ErbB3 isoform lacks the intermembrane region, is secreted outside the cell, and acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.

Specifications

• Accession Number: P21860
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2065
• Name: Human ErbB3 (aa 1022-1116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: avian erythroblastosis oncogene B 3; avian erythroblastosis oncogene B 3 receptor; C76256; c-erbB3; c-erbB-3; C-errB-3; erb-b2 receptor tyrosine kinase 3; ERBB3; Erbb-3; Erbb3r; erbB3-S; glial growth factor receptor; HER3; human epidermal growth factor receptor 3; LCCS2; MDA BF 1; MDA-BF-1; MGC88033; nuc-ErbB3; p180 ErbB3; p180-ErbB3; p45 sErbB3; p45-sErbB3; p85 sErbB3; p85-sErbB3; proto-oncogene-like protein c-ErbB-3; receptor tyrosine kinase; receptor tyrosine-protein kinase erbB-3; receptor tyrosine-protein kinase erbB-3; LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-3; tyrosine kinase-type cell surface receptor HER3; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
• Common Name: Her-3 (ErbB3)
• Gene Symbol: ERBB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining