Invitrogen™ Human ERAB (aa 48-166) Control Fragment Recombinant Protein

Product Code. 30210530

Brand: Invitrogen™ RP91912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimer's disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Specifications

• Accession Number: Q99714
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3028
• Name: Human ERAB (aa 48-166) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17 bHSD10; 17 b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; ABAD; AB-binding alcohol dehydrogenase; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; CAMR; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HADH2 protein; HCD2; HSD17B10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; mitochondrial ribo; Mitochondrial ribonuclease P protein 2; mitochondrial RNas; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MR x 17; MR x 31; MRXS10; RP3-339A18.2; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5 C member 1; short chain dehydrogenase/reductase family 5 C, member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; type 10 17 b-HSD; Type II HADH; XH98G2
• Common Name: ERAB
• Gene Symbol: HSD17B10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining