missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211938

Invitrogen™ Human EpoR (aa 405-508) Control Fragment Recombinant Protein

Product Code. 30211938
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211938

Brand: Invitrogen™ RP109643

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EpoR encodes the erythropoietin receptor, which belongs to the cytokine receptor family. When erythropoietin binds to this receptor, it activates the Jak2 tyrosine kinase, which in turn activates various intracellular pathways including Ras/MAP kinase, phosphatidylinositol 3-kinase, and STAT transcription factors. The stimulated erythropoietin receptor plays a role in the survival of erythroid cells. Defects in this gene may result in erythroleukemia and familial erythrocytosis. Dysregulation of this gene may also affect the growth of certain tumors. Multiple transcript variants are produced as a result of alternate splicing. Diseases associated with EPOR include Erythrocytosis, Familial, 1 and Erythroleukemia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19235
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2057
Name Human EpoR (aa 405-508) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EPO R; EPOR; EPO-R; Erythropoietin receptor; pEpoR
Common Name EpoR
Gene Symbol EPOR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.