Invitrogen™ Human EPM2A Control Fragment Recombinant Protein

Artikelnummer.	Quantity	unitSize
30200149	100 μL	100µL

Artikelnummer. 30200149 Lieferant Invitrogen™ Lieferanten-Nr. RP101738

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111418 (PA5-111418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Epilepsy, progressive myoclonus type 2A protein (EPM2A) is a dual-specificity phosphatase that associates with polyribosomes. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. EPM2A interacts with a number of proteins known to be involved in glycogen metabolism and has been shown to have robust phosphatase activity against a phosphorylated complex carbohydrate, suggesting that EPM2A may be involved in the regulation of glycogen metabolism.

Spezifikation

• Accession Number: O95278
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7957
• Name: Human EPM2A Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: epilepsy, progressive myoclonic epilepsy, type 2 gene alpha; epilepsy, progressive myoclonus type 2, Lafora disease (laforin); epilepsy, progressive myoclonus type 2 A; epilepsy, progressive myoclonus type 2 A, Lafora disease (laforin); EPM2; EPM2A; EPM2A glucan phosphatase, laforin; EPM2A, laforin glucan phosphatase; glucan phosphatase; Glycogen phosphatase; Lafora PTPase; laforin; LAFPTPase; MELF; RP1-28C20.2; Tg(TcraK,TcrbK)TG-BFlv; TG-B
• Common Name: EPM2A
• Gene Symbol: EPM2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFFQKFGKVRSSVCS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining