Invitrogen™ Human Epigen (aa 18-109) Control Fragment Recombinant Protein

Product Code. 30205839

Brand: Invitrogen™ RP90531

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64953 (PA5-64953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases. It is produced in several tissues, including the testis, liver, and heart, as well as in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated 14.7 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.

Specifications

• Accession Number: Q6UW88
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 255324
• Name: Human Epigen (aa 18-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310069M11Rik; ALGV3072; EPG; EPGN; epigen; epithelial mitogen; epithelial mitogen homolog; PRO9904; RGD1560084; UNQ3072/PRO9904
• Common Name: Epigen
• Gene Symbol: EPGN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining