missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203113

Invitrogen™ Human Ephrin A2 (aa 144-212) Control Fragment Recombinant Protein

Product Code. 30203113
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203113

Brand: Invitrogen™ RP108532

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111624 (PA5-111624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Eph subfamily represents the largest group of receptor protein tyrosine kinases identified to date. While the biological activities of these receptors have yet to be determined, there is increasing evidence that they are involved in central nervous system function and in development. The Eph subfamily receptors of human origin (and their murine/avian homologs) include EphA1(Eph), EphA2 (Eck), EphA3 (Hek4), EphA4 (Hek8), EphA5 (Hek7), EphA6 (Hek12), EphA7 (Hek11/MDK1), EphA8 (Hek3), EphB1 (Hek6), EphB2 (Hek5), EphB3(Cek10, Hek2), EphB4 (Htk), EphB5 (Hek9) and EphB6 (Mep). Ligands for Eph receptors include ephrin-A4 (LERK-4) which binds EphA3 and EphB1. In addition, Ephrin-A2 (Elf-1) has been described as the ligand for EphA4, ephrin-A3 (Ehk1-L) as the ligand for EphA5 and ephrin-B2 (Htk-L) as the ligand for EphB4 (Htk).
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number O43921
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1943
Name Human Ephrin A2 (aa 144-212) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CEK7L; CEK7-L; CEK7-ligand; EFNA2; Elf1; ELF-1; EPH related receptor tyrosine kinase ligand 6; eph-related receptor tyrosine kinase ligand 6; ephrin A2; ephrin A-2; ephrin A6; EphrinA2; ephrin-A2; Epl6; EPLG6; HEK7 ligand; HEK7-L; Lerk6; LERK-6
Common Name Ephrin A2
Gene Symbol EFNA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.