Invitrogen™ Human Ephrin A1 (aa 110-182) Control Fragment Recombinant Protein

Product Code. 30195510

Brand: Invitrogen™ RP109192

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ephrin family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.

Specifications

• Accession Number: P20827
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1942
• Name: Human Ephrin A1 (aa 110-182) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI325262; B61; ECKLG; EFL1; Efna1; Epgl1; EPH-related receptor tyrosine kinase ligand 1; ephrin A1; ephrin-A1; Ephrin-A1, secreted form; Epl1; EPLG1; Immediate early response protein B61; Lerk1; LERK-1; ligand of eph-related kinase 1; TNF alpha-induced protein 4; TNFAIP4; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4
• Common Name: Ephrin A1
• Gene Symbol: EFNA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining