Invitrogen™ Human EphB2 (aa 269-332) Control Fragment Recombinant Protein

Product Code. 30202933

Brand: Invitrogen™ RP105524

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EPHB2 is a receptor tyrosine kinase that belongs to the ephrin receptor family. Members of the Eph family of kinases play important roles in diverse biological processes including nervous system development, angiogenesis and neural synapsis formation and maturation. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. EphB4 binds to ephrin-B2 and plays an essential role in vascular development.

Specifications

• Accession Number: P29323
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2048
• Name: Human EphB2 (aa 269-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CAPB; cEK5; chicken embryo kinase 5; chicken embryo kinase 5 protein; developmentally-regulated Eph-related tyrosine kinase; DRT; EFL6; EFNB3; EK5; ELK; ELK-related tyrosine kinase; embryo kinase 5 protein CEK5; EPH B2; EPH receptor B2; eph tyrosine kinase 3; EPHB2; EphB2/CTF1; EphB2/CTF2; EPHB3; EPH-like kinase 5; Ephrin B1; Ephrin B2; Ephrin B3; Ephrin B4; Ephrin type-B receptor 2; EphrinB1; EphrinB2; EphrinB3; EphrinB4; EPHT3; EPLG8; EPTH3; ERK; ETECK; ETK2; HEK2; Hek5; HEK-6; LERK8; MGC87492; NET; Neural kinase; Nuk; Nuk receptor tyrosine kinase; PCBC; Prkm5; protein-tyrosine kinase HEK5; Qek5; Renal carcinoma antigen NY-REN-47; RGD1564232; Sek3; TYRO5; TYRO6; Tyrosine-protein kinase receptor EPH-3; tyrosine-protein kinase receptor SEK-3; Tyrosine-protein kinase TYRO5
• Common Name: EphB2
• Gene Symbol: EPHB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining