Invitrogen™ Human EPG5 (aa 819-947) Control Fragment Recombinant Protein

Product Code. 30197473

Brand: Invitrogen™ RP92423

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56819 (PA5-56819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9HCE0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57724
• Name: Human EPG5 (aa 819-947) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732475F16; 5430411K18Rik; AI661957; AW456499; Ectopic P granules protein 5 homolog; ectopic P-granules autophagy protein 5 homolog; ectopic P-granules autophagy protein 5 homolog (C. elegans); Epg5; HEEW1; HEEW1 antibody; hEPG5 antibody; Kiaa1632; mKIAA1632; RGD1306286; VICIS
• Common Name: EPG5
• Gene Symbol: EPG5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGRELLGTITAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVKNKLACVILEGLNWGFAKQATLHLDQAVHAEVALMVLEAYQKYLAQKPYAGILSESMKQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining