missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EPB41L4B (aa 577-689) Control Fragment Recombinant Protein

Product Code. 30194892
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194892

Brand: Invitrogen™ RP92888

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60150 (PA5-60150. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Up-regulates the activity of the Rho guanine nucleotide exchange factor ARHGEF18. Involved in the regulation of the circumferential actomyosin belt in epithelial cells (PubMed:22006950). Promotes cellular adhesion, migration and motility in vitro and may play a role in wound healing (PubMed:23664528). May have a role in mediating cytoskeletal changes associated with steroid-induced cell differentiation (PubMed:14521927). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H329
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54566
Name Human EPB41L4B (aa 577-689) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430543G08Rik; AA589614; AU021054; band 4.1-like protein 4 B; BB007528; CG1; D4Ertd346e; Ehm2; Epb4.1l4b; EPB41L4B; erythrocyte membrane protein band 4.1 like 4 B; erythrocyte protein band 4.1 like 4 b; erythrocyte protein band 4.1-like 4 b; erythrocyte protein band 4.1-like 4 b; expressed in high-metastatic cells; expressed in high-metastatic cells; FERM-containing protein CG1; LULU2; Protein EHM2; RGD1562988
Common Name EPB41L4B
Gene Symbol EPB41L4B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.