missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EPB41 (aa 97-198) Control Fragment Recombinant Protein

Product Code. 30194843
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194843

Brand: Invitrogen™ RP108778

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4. 1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11171
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2035
Name Human EPB41 (aa 97-198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4.1 R; AI415518; Band 4.1; D4Ertd442e; E41P; EL1; elliptocytosis 1, RH-linked; Elp1; Elp-1; EPB4.1; EPB41; erythrocyte membrane protein band 4.1; erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked); erythrocyte protein band 4.1; erythrocyte skeletal protein; erythrocyte surface protein band 4.1; HE; Kiaa4056; mKIAA4056; P4.1; protein 4.1; Protein 4.1 R; RGD1564762
Common Name EPB41
Gene Symbol EPB41
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.