Invitrogen™ Human ENTPD7 (aa 324-415) Control Fragment Recombinant Protein

Product Code. 30194761

Brand: Invitrogen™ RP91057

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53150 (PA5-53150. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ENTPD7 is a multi-pass membrane protein. It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP - GTP - CTP.

Specifications

• Accession Number: Q9NQZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57089
• Name: Human ENTPD7 (aa 324-415) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810012B13Rik; 1810020C02Rik; 2810003F23Rik; ectonucleoside triphosphate diphosphohydrolase 7; ENTPD7; Kiaa4066; Lalp1; Lysal2; lysosomal apyrase-like 2; lysosomal apyrase-like protein 1; NTPDase 7; RP11-483F11.1
• Common Name: ENTPD7
• Gene Symbol: ENTPD7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining