Invitrogen™ Human ENTPD6 (aa 281-378) Control Fragment Recombinant Protein

Product Code. 30193976

Brand: Invitrogen™ RP107698

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84816 (PA5-84816. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which are characteristic of NTPases. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Specifikationer

• Accession Number: O75354
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 955
• Name: Human ENTPD6 (aa 281-378) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700026H11Rik; CD39 antigen-like 2; CD39L2; CD39-like 2; dJ738P15.3; Ectonucleoside triphosphate diphosphohydrolase 6; ectonucleoside triphosphate diphosphohydrolase 6 (putative); Entpd6; IL-6 SAG; IL6ST2; interleukin 6 signal transducer-2; NTPDase 6; NTPDase-6; RP4-738P15.5
• Common Name: ENTPD6
• Gene Symbol: Entpd6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining