missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ENT2 (aa 217-289) Control Fragment Recombinant Protein

Product Code. 30213035
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213035

Brand: Invitrogen™ RP91298

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53746 (PA5-53746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC29A2 is a member of the equilibrative nucleoside transporter family which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis. SLC29A2 is a transmembrane glycoprotein that mediates the cellular uptake of nucleosides from the surrounding medium. As a nucleoside transporter, SLC29A2 plays an important role in the uptake of nucleoside-based anti-cancer drugs; polymorphisms of point mutations in the gene encoding this protein may affect the efficacy of these drugs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14542
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3177
Name Human ENT2 (aa 217-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 36 kDa hydrophobic nucleolar protein; 36 kDa nucleolar protein HNP36; delayed early response gene 12; delayed-early response protein 12; DER12; ENT2; equilibrative NBMPR-insensitive nucleoside transporter; Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter; equilibrative nucleoside transporter 2; HNP36; hydrophobic nucleolar protein, 36 kDa; hydrophobic nucleolar protein, 36 kD; NBMPR-insensitive nucleoside transporter ei; NBMPR-insensitive nucleoside transporter ei 2 A; nucleoside transporter, ei-type; rbENT2A; Slc29a2; solute carrier family 29 (equilibrative nucleoside transporter), member 2; solute carrier family 29 (nucleoside transporters), member 2; solute carrier family 29 member 2; solute carrier family 29, member 2
Common Name ENT2
Gene Symbol SLC29A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.