Invitrogen™ Human ENT2 (aa 217-289) Control Fragment Recombinant Protein

Product Code. 30213035

Brand: Invitrogen™ RP91298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53746 (PA5-53746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC29A2 is a member of the equilibrative nucleoside transporter family which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis. SLC29A2 is a transmembrane glycoprotein that mediates the cellular uptake of nucleosides from the surrounding medium. As a nucleoside transporter, SLC29A2 plays an important role in the uptake of nucleoside-based anti-cancer drugs; polymorphisms of point mutations in the gene encoding this protein may affect the efficacy of these drugs.

Specifications

• Accession Number: Q14542
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3177
• Name: Human ENT2 (aa 217-289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 36 kDa hydrophobic nucleolar protein; 36 kDa nucleolar protein HNP36; delayed early response gene 12; delayed-early response protein 12; DER12; ENT2; equilibrative NBMPR-insensitive nucleoside transporter; Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter; equilibrative nucleoside transporter 2; HNP36; hydrophobic nucleolar protein, 36 kDa; hydrophobic nucleolar protein, 36 kD; NBMPR-insensitive nucleoside transporter ei; NBMPR-insensitive nucleoside transporter ei 2 A; nucleoside transporter, ei-type; rbENT2A; Slc29a2; solute carrier family 29 (equilibrative nucleoside transporter), member 2; solute carrier family 29 (nucleoside transporters), member 2; solute carrier family 29 member 2; solute carrier family 29, member 2
• Common Name: ENT2
• Gene Symbol: SLC29A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining