Invitrogen™ Human ENT1 (aa 228-287) Control Fragment Recombinant Protein

Product Code. 30213275

Brand: Invitrogen™ RP90663

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the equilibrative nucleoside transporter family. The gene encodes a transmembrane glycoprotein that localizes to the plasma and mitochondrial membranes and mediates the cellular uptake of nucleosides from the surrounding medium. The protein is categorized as an equilibrative transporter that is sensitive to inhibition by nitrobenzylthioinosine. Nucleoside transporters are required for nucleotide synthesis in cells that lack de novo nucleoside synthesis pathways, and are also necessary for the uptake of cytotoxic nucleosides used for cancer and viral chemotherapies. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.

Specifications

• Accession Number: Q99808
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2030
• Name: Human ENT1 (aa 228-287) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200014D21Rik; AA407560; ENT1; Equilibrative NBMPR-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside (NBMPR)-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter; Equilibrative nucleoside transporter 1; equilibrative nucleoside transporter 1 variant delta 11; HENT1; NBMPR-sensitive equilibrative nucleoside transporter; nucleoside transporter, es-type; rENT1; SLC29A1; solute carrier family 29 (equilibrative nucleoside transporter), member 1; solute carrier family 29 (nucleoside transporters), member 1; solute carrier family 29 member 1; solute carrier family 29 member 1 (Augustine blood group); solute carrier family 29, member 1
• Common Name: ENT1
• Gene Symbol: SLC29A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining