Invitrogen™ Human Endothelin 2 (aa 92-176) Control Fragment Recombinant Protein

Product Code. 30199141

Brand: Invitrogen™ RP94180

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Endothelins are endothelium-derived vasoconstrictor peptides. Endothelin 2, also known as ET-2, is a protein that in humans is encoded by the EDN2 gene. The secreted peptide (∽2kD, 21 amino acids) is produced as a result of endothelin-2 precursor (∽20 kD) processing and functions as a ligand for endothelin receptors which upon peptide binding modulates a wide array of cell signaling events. Diseases associated with endothelins include aortic disease and patent ductus arteriosus.

Specifications

• Accession Number: P20800
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1907
• Name: Human Endothelin 2 (aa 92-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EDN 2; Edn2; EDN-2; endothelin 2; Endothelin isopeptide 2; endothelin-2; ET2; ET-2; PP ET-2; PPET2; preproendothelin 2; preproendothelin-2; RNEDN2S01; vasoactive intestinal contractor; vasoactive intestinal contractor peptide; VIC
• Common Name: Endothelin 2
• Gene Symbol: EDN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining