Invitrogen™ Human EMP (aa 73-145) Control Fragment Recombinant Protein

Product Code. 30211547

Brand: Invitrogen™ RP106828

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66147 (PA5-66147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturation and enucleation of erythroblasts, presumably by suppressing apoptosis. This protein is an integral membrane protein with the N-terminus on the extracellular side and the C-terminus on the cytoplasmic side of the cell. Two immunologically related isoforms of erythroblast macrophage protein with apparent molecular weights of 33 kD and 36 kD were detected in macrophage membranes, this gene encodes the larger isoform. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Specifications

• Accession Number: Q7L5Y9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10296
• Name: Human EMP (aa 73-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110030D19Rik; Cell proliferation-inducing gene 5 protein; E3 ubiquitin-protein transferase MAEA; EMLP; EMP; Erythroblast macrophage protein; GID complex subunit 9, FYV10 homolog; GID9; HLC10; HLC-10; Human lung cancer oncogene 10 protein; lung cancer-related protein 10; macrophage erythroblast attacher; MAEA; P44EMLP; PIG5
• Common Name: EMP
• Gene Symbol: MAEA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining