Invitrogen™ Human EML2 (aa 319-436) Control Fragment Recombinant Protein

Product Code. 30208301

Brand: Invitrogen™ RP90183

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52980 (PA5-52980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic. Target protein is a microtubule-associated protein that binds to the delta2 glutamate receptor.

Specifications

• Accession Number: O95834
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 24139
• Name: Human EML2 (aa 319-436) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600029N02Rik; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT-associated protein (EMAP)-like protein 70; ELP70; EMAP2; EMAP-2; EMAPL2; EML2; microtubule-associated protein like echinoderm EMAP
• Common Name: EML2
• Gene Symbol: EML2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining