Invitrogen™ Human EMC7 (aa 52-157) Control Fragment Recombinant Protein

Product Code. 30213241

Brand: Invitrogen™ RP106150

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65474 (PA5-65474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EMC7 (ER Membrane Protein Complex Subunit 7) is a Protein Coding gene. Diseases associated with EMC7 include Cone-Rod Dystrophy, X-Linked, 1. Gene Ontology (GO) annotations related to this gene include carbohydrate binding. [GeneCards]

Specifications

• Accession Number: Q9NPA0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56851
• Name: Human EMC7 (aa 52-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900064A13Rik; AI451465; c11orf3; C15orf24; chromosome 15 hypothetical ATG/GTP binding protein; Emc7; ER membrane protein complex subunit 7; HT022; ORF1-FL1; Orf3; UNQ905/PRO1926; UPF0480 protein C15orf24; UPF0480 protein C15orf24 homolog
• Common Name: EMC7
• Gene Symbol: EMC7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining