Invitrogen™ Human ELOA (aa 253-382) Control Fragment Recombinant Protein

Product Code. 30213159

Brand: Invitrogen™ RP89284

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52224 (PA5-52224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the transcriptionally active subunit of the SIII (or elongin) transcription elongation factor complex, which also includes two regulatory subunits, elongins B and C. This complex acts to increase the rate of RNA chain elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites along the DNA template. Whereas a related protein with similar function, elongin A, is ubiquitously expressed, the encoded protein is specifically expressed in the testis, suggesting it may have a role in spermatogenesis.

Specifications

• Accession Number: Q14241, Q8IYF1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51224, 6924
• Name: Human ELOA (aa 253-382) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 110 kDa; AA408125; El; EloA; EloA2; Elongin 110 kDa subunit; elongin A; Elongin A2; elongin-A; Elongin-A2; MSTP059; RNA polymerase II transcription factor elongin subunit A (110 kDa); RNA polymerase II transcription factor SIII subunit A; RNA polymerase II transcription factor SIII subunit A1; SIII; SIII p110; TCEB3; TCEB3A; TCEB3B; TCEB3L; transcription elongation factor B (SIII), polypeptide 3; transcription elongation factor B (SIII), polypeptide 3 (110 kDa, elongin A); transcription elongation factor B alpha subunit; transcription elongation factor B polypeptide 3; transcription elongation factor B subunit 3
• Common Name: ELOA
• Gene Symbol: ELOA, ELOA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining